PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV40562.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family NAC
Protein Properties Length: 471aa    MW: 53621.5 Da    PI: 8.8656
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV40562.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM138.73.7e-4361362128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                 +pGfrF Pt+eelv +yL++k++g+k e+++vi+ +diy+++P+dLp+    ++  ++++++fF++r++++ +g r+nr t++gyWkatg+  +v+s++
  KZV40562.1   6 TPGFRFYPTEEELVLFYLHHKLRGTKPEIDRVIPVLDIYEYHPSDLPQlageCCPVDSEQCFFFIPRHEREVRGGRPNRLTSHGYWKATGSPGDVYSSQ 104
                 69***************************999***************6456544458889*************************************** PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                 ++++g kkt+vfy+grap+g+kt W m+ey++
  KZV40562.1 105 NRVIGRKKTMVFYEGRAPNGRKTAWKMNEYKA 136
                 ******************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100545.7035166IPR003441NAC domain
SuperFamilySSF1019415.62E-456166IPR003441NAC domain
PfamPF023653.7E-207135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MGEFSTPGFR FYPTEEELVL FYLHHKLRGT KPEIDRVIPV LDIYEYHPSD LPQLAGECCP  60
VDSEQCFFFI PRHEREVRGG RPNRLTSHGY WKATGSPGDV YSSQNRVIGR KKTMVFYEGR  120
APNGRKTAWK MNEYKAMETD LDASSTSAQE NPQVREELSL CRIYQRSNFF RAYDRRPPPS  180
DAVIVVAEHR QAATTSTDPE IGVDGSSIGD QDNTYHSLGR LNLHSVQLGY LKILQMGNTD  240
PNNAKQENKY ELDQRINWQI KSLEPLYHAQ QVSRWKSSVR DFRVRQPITA RWSSDTTNQS  300
VTTPMIALDF LGTTNQSASH NVALKQVINS ICQLGSRCML VCQPLYHAQQ VSRWKSSVRD  360
FRVRQPITAR WSSDTTNQSV TTPMIALDFF GTTNQSSSHN VALKQNHIIK SHNINYSHVD  420
AKAAKSAQLV PQFLKILPHR FLKCTTGLPV CTRVIRSNLL VDPSEVEEGE M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-29716822170NAC domain-containing protein 19
3swp_C3e-29716822170NAC domain-containing protein 19
3swp_B3e-29716822170NAC domain-containing protein 19
3swp_A3e-29716822170NAC domain-containing protein 19
3swm_D3e-29716822170NAC domain-containing protein 19
3swm_C3e-29716822170NAC domain-containing protein 19
3swm_B3e-29716822170NAC domain-containing protein 19
3swm_A3e-29716822170NAC domain-containing protein 19
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44350.25e-71NAC domain containing protein 61